PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG010200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 492aa    MW: 52287.1 Da    PI: 6.1386
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG010200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS224.55.2e-691224902374
                 GRAS   2 velLlecAeavssgdlelaqalLarlsel..aspdg.dpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsev 87 
                          v+ Lle+A+  +sgd + a+++Larl+++  + p g  p+ R+aa++  AL + l+   +++ +   + s++s+ +++ +laa+k++ ++
  Pavir.4KG010200.1.p 122 VDELLEAARRADSGDSTGAREILARLNHRlpSPPLGyPPLLRAAAHLRDALLRLLVPpPGPGSV---S-SSSSPLDVALKLAAHKALADA 207
                          678*************************99778888889*****************93333333...3.333345699************ PP

                 GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...eg......ppslRiTgvgspesg.....skeeleetge 163
                          sP+++f+ +t  qa+l+a+  ++rvH++D+d++ G+ Wp+L+q+La +    +       pps+++T+++s ++g     ++ el+  +e
  Pavir.4KG010200.1.p 208 SPTVQFASFTSTQALLDALGAARRVHVVDLDVGFGARWPPLMQELALQWrraSAasqllpPPSIKVTALVSISPGypahpNNMELRLARE 297
                          **********************************************5442242155566599*********99999999999******** PP

                 GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                           L++fA+ lg++fef+++v + l        +  pgEa+aV+l l   ++            + L++vk+l+P +vv+ve    + + ++
  Pavir.4KG010200.1.p 298 SLTRFAADLGIRFEFDAVVFDPLGLDPSPPVAAAPGEAVAVHLPLGSGTFS---P-----ALAALRVVKQLRPAIVVCVETFGGC-HLPL 378
                          ******************999999999999***************999997...3.....4457****************99888.89** PP

                 GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                           ++ l+ ++  +a+++sl+a  ++ +++ +kvE+ +l+++++ ++              + W+ ++ +aG+ pv+ls+ a++qa++l+r+
  Pavir.4KG010200.1.p 379 SHHALNVVRSGAAFLESLDAA-GAPADAVAKVEQYILRPRVERLLLSDRMP--------APWQTMFASAGLAPVQLSSAAEAQAECLVRR 459
                          ******************988.7888999***************9987766........89***************************** PP

                 GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          ++  g++ve+++++l l W++ +Lv+vSaWr
  Pavir.4KG010200.1.p 460 TPTPGFHVEKRQAALALRWQQSELVTVSAWR 490
                          ******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.34795470IPR005202Transcription factor GRAS
PfamPF035141.8E-66122490IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MPPRRPTSAY AGRRRRSPPP CSTTAAPARP PHPPSPEPPP PISAEDWEAV LSAGDMAAPP  60
AADSCFEFQL LPWIMDDDDD TLDPFLAPPL CQEPAIEPLL LQPPQPAPLP VAEEDLQPQA  120
VVDELLEAAR RADSGDSTGA REILARLNHR LPSPPLGYPP LLRAAAHLRD ALLRLLVPPP  180
GPGSVSSSSS PLDVALKLAA HKALADASPT VQFASFTSTQ ALLDALGAAR RVHVVDLDVG  240
FGARWPPLMQ ELALQWRRAS AASQLLPPPS IKVTALVSIS PGYPAHPNNM ELRLARESLT  300
RFAADLGIRF EFDAVVFDPL GLDPSPPVAA APGEAVAVHL PLGSGTFSPA LAALRVVKQL  360
RPAIVVCVET FGGCHLPLSH HALNVVRSGA AFLESLDAAG APADAVAKVE QYILRPRVER  420
LLLSDRMPAP WQTMFASAGL APVQLSSAAE AQAECLVRRT PTPGFHVEKR QAALALRWQQ  480
SELVTVSAWR C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2116349042375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140725.10.0scarecrow-like 6
TrEMBLK0DCK50.0K0DCK5_MAIZE; GRAS32 GRAS type transcription factor (Fragment)
TrEMBLB4FQS80.0B4FQS8_MAIZE; Scarecrow-like 6
STRINGGRMZM2G051785_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145372224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.18e-57GRAS family protein